PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29889.m003281
Common NameRCOM_1000290
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family GRAS
Protein Properties Length: 454aa    MW: 51417.8 Da    PI: 8.1311
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29889.m003281genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS244.15.9e-75674364373
           GRAS   4 lLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn..sseelaalkl..fsevs...Pilk 92 
                    lLl+ A+ v ++++  a++lL+    l+s++g+++qR+++yft+AL+ r+++++++++++ + s++++       e+++     +  ++   P+l+
  29889.m003281  67 LLLASAHRVGNRQFDHASKLLNLCDFLSSNKGNSVQRVVHYFTKALQDRISQESETVSSKRSESKERKLLypA--EITVGVNpaLIWCClqlPCLQ 160
                    79999***********************************************888888776666666444442..33322113344444444**** PP

           GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrle 187
                    + +++  qa+ +++++++rvH iDf+i+ G++   L+qaLa+R+e p   l+i gvg   + s++++e  g+ La fA++l++pf+f+++++ +++
  29889.m003281 161 LVQFAGIQAVIDSLDSAKRVHFIDFGIKTGGHCTVLMQALANRQECPIeLLKISGVGV--KASRQRIEDAGKSLACFANTLDLPFSFKTIIVASIK 254
                    ********************************************7665499*******..55********************************** PP

           GRAS 188 dleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseeri 283
                    dl+ ++++v+ gE++aV l   l  + +++ +l+     +L ++++l+P v+v++e  ++h+s+ F + fle l +ys++fd +e  + + + +ri
  29889.m003281 255 DLKKDMFEVSDGEVVAVYLPSILRFIKAQQDCLQC----LLTVLRKLNPCVMVIIEPVLNHSSPIFIDSFLEVLLFYSTCFDGVEGCIDQCDPNRI 346
                    ********************988888877777777....********************************************************* PP

           GRAS 284 kvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaW 373
                    +vE+  +g+ei++++a++ +er+ +h ++ +Wr+ + ++G+ + ++s +   qa+l+l++++ ++   +  + ++l+ gWk+ pL+s+SaW
  29889.m003281 347 SVEAS-MGQEIRDIIAAKDEERIFEHMKMDEWRDYFIRFGMVETQVSMSSFYQAELMLKNFAsGKSCLLVRNGKCLMTGWKETPLLSLSAW 436
                    *****.********************************************************88889999999****************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098532.5838416IPR005202Transcription factor GRAS
PfamPF035142.0E-7267436IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 454 aa     Download sequence    Send to blast
MRQALTTWIM ASVRRISTQE IMRISRAWFR RISSEKLIDL STIQRLFDGS QFGLSGEEIK  60
DVELSLLLLA SAHRVGNRQF DHASKLLNLC DFLSSNKGNS VQRVVHYFTK ALQDRISQES  120
ETVSSKRSES KERKLLYPAE ITVGVNPALI WCCLQLPCLQ LVQFAGIQAV IDSLDSAKRV  180
HFIDFGIKTG GHCTVLMQAL ANRQECPIEL LKISGVGVKA SRQRIEDAGK SLACFANTLD  240
LPFSFKTIIV ASIKDLKKDM FEVSDGEVVA VYLPSILRFI KAQQDCLQCL LTVLRKLNPC  300
VMVIIEPVLN HSSPIFIDSF LEVLLFYSTC FDGVEGCIDQ CDPNRISVEA SMGQEIRDII  360
AAKDEERIFE HMKMDEWRDY FIRFGMVETQ VSMSSFYQAE LMLKNFASGK SCLLVRNGKC  420
LMTGWKETPL LSLSAWNFQQ EHSKKNCTKK SKVY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-239443633374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002519210.20.0PREDICTED: DELLA protein GAI1
TrEMBLB9RZP10.0B9RZP1_RICCO; DELLA protein GAI1, putative
STRINGPOPTR_0010s15330.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.12e-46RGA-like 2